PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun007288
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARF
Protein Properties Length: 381aa    MW: 42408.8 Da    PI: 7.474
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-13572PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B378.75.9e-2548149199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + +++el++
  Vun007288  48 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyS-QQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGELRL 144
                99****************************963.3445679************************************************..3489999** PP

                EEE-S CS
         B3  95 kvfrk 99 
                +++r+
  Vun007288 145 GIRRA 149
                **996 PP

2Auxin_resp119.13.6e-39174255182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +++a+s +++F+v+YnPr s+seF+++v+k++k+l++++ vGmRf+m+feted++err++G+++g+sd+dpvrWp+SkWr+L
   Vun007288 174 VVNALSARCAFSVCYNPRFSSSEFIIPVHKFLKSLDCSYLVGMRFRMRFETEDAAERRFTGLIAGISDVDPVRWPGSKWRCL 255
                 6899*****************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.88E-4341156IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-4042151IPR015300DNA-binding pseudobarrel domain
CDDcd100173.08E-2346148No hitNo description
SMARTSM010193.4E-2348150IPR003340B3 DNA binding domain
PROSITE profilePS5086313.39448150IPR003340B3 DNA binding domain
PfamPF023624.6E-2348149IPR003340B3 DNA binding domain
PfamPF065078.5E-34175255IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
XSDEVYCQVL LVPESEQVEQ SLREGEIEAD GEEEDTEAMV KSTTPHMFCK TLTASDTSTH  60
GGFSVPRRAA EDCFPPLDYS QQRPSQELVA KDLHGLEWRF RHIYRGQPRR HLLTTGWSAF  120
VNKKKLVSGD AVLFLRGDDG ELRLGIRRAA QLKGSGSFAV PTGQQLNPGT FMDVVNALSA  180
RCAFSVCYNP RFSSSEFIIP VHKFLKSLDC SYLVGMRFRM RFETEDAAER RFTGLIAGIS  240
DVDPVRWPGS KWRCLLVRWD DMEAARHNRV SPWEIEPSGS ASSASSSSNM MAAGLKRTRI  300
GMTSTKMEFP SPNGIGTSDF GESLRFRKVL QGQEILGVNP PFDGINAQTP RLYDLGRYYI  360
GPNCPGIPPT GNNIRMPHGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B4e-92228488361Auxin response factor 1
4ldw_A4e-92228488361Auxin response factor 1
4ldv_A4e-92228488361Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518977.10.0PREDICTED: auxin response factor 3-like
SwissprotO236611e-163ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0L9VFP10.0A0A0L9VFP1_PHAAN; Auxin response factor
STRINGGLYMA13G30750.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-149ARF family protein